Isolation and characterization of a diuretic peptide common to the house fly and stable fly

An identical CRF-related diuretic peptide ( Musca-DP) was isolated and characterized from whole-body extracts of the house fly, Musca domestica, and stable fly, Stomoxys calcitrans. The peptide stimulates cyclic AMP production in Manduca sexta Malpighian tubules and increases the rate of fluid secre...

Ausführliche Beschreibung

Gespeichert in:

Bibliographische Detailangaben
Veröffentlicht in:	Peptides (New York, N.Y. : 1980) N.Y. : 1980), 1994, Vol.15 (6), p.971-979
Hauptverfasser:	Clottens, Frank L., Holman, G.Mark, Coast, Geoffrey M., Totty, Nicholas F., Hayes, Timothy K., Kay, Iain, Mallet, Anthony I., Wright, Mark S., Chung, Jum-Sook, Truong, Oanh, Bull, Don L.
Format:	Artikel
Sprache:	eng
Schlagworte:	Amino Acid Sequence Animals Biochemistry. Physiology. Immunology Biological and medical sciences Corticotropin-releasing factor-like peptides Corticotropin-Releasing Hormone - analogs & derivatives Cyclic AMP Cyclic AMP - metabolism Diuretics - chemistry Diuretics - isolation & purification Diuretics - pharmacology Fluid secretion Fundamental and applied biological sciences. Psychology Houseflies - chemistry Insecta Invertebrates Malpighian tubules Malpighian Tubules - drug effects Manduca - drug effects Manduca sexta Mass Spectrometry Molecular Sequence Data Musca domestica Muscidae - chemistry Peptides - chemistry Peptides - isolation & purification Peptides - pharmacology Physiology. Development Sequence Analysis Sequence Homology, Amino Acid Stomoxys calcitrans
Online-Zugang:	Volltext
Tags:	Tag hinzufügen Keine Tags, Fügen Sie den ersten Tag hinzu!

Beschreibung
Zusammenfassung:	An identical CRF-related diuretic peptide ( Musca-DP) was isolated and characterized from whole-body extracts of the house fly, Musca domestica, and stable fly, Stomoxys calcitrans. The peptide stimulates cyclic AMP production in Manduca sexta Malpighian tubules and increases the rate of fluid secretion by isolated Musca domestica tubules. The 44-residue peptide, with a mol.wt. of 5180, is amidated, and has the primary structure: NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV-NH 2. Musca-DP has a high percentage of sequence identity with other characterized CRF-related insect diuretic peptides.
ISSN:	0196-9781 1873-5169
DOI:	10.1016/0196-9781(94)90059-0