In vitro activities of small peptides from snake venom against clinical isolates of drug-resistant Mycobacterium tuberculosis

The recent re-emergence of tuberculosis, especially the multidrug-resistant cases, has highlighted the importance of screening effective novel drugs against Mycobacterium tuberculosis. In this study, the in vitro activities of small peptides isolated from snake venom were investigated against multid...

Ausführliche Beschreibung

Gespeichert in:

Bibliographische Detailangaben
Veröffentlicht in:	International journal of antimicrobial agents 2003-08, Vol.22 (2), p.172-174
Hauptverfasser:	Xie, J.P., Yue, J., Xiong, Y.L., Wang, W.Y., Yu, S.Q., Wang, H.H.
Format:	Artikel
Sprache:	eng
Schlagworte:	Amino Acid Sequence Animals Antibacterial agents Antibiotics. Antiinfectious agents. Antiparasitic agents Antitubercular Agents - chemistry Antitubercular Agents - isolation & purification Antitubercular Agents - pharmacology Biological and medical sciences Drug Resistance, Multiple, Bacterial Elapidae - genetics Elapidae - metabolism Humans In Vitro Techniques Medical sciences Molecular Sequence Data Multidrug resistance Mycobacterium tuberculosis Mycobacterium tuberculosis - drug effects Mycobacterium tuberculosis - isolation & purification Naja atra Peptides - chemistry Peptides - genetics Peptides - isolation & purification Peptides - pharmacology Pharmacology. Drug treatments Small peptide Snake venom Snake Venoms - chemistry Tuberculosis, Multidrug-Resistant - drug therapy Tuberculosis, Multidrug-Resistant - microbiology
Online-Zugang:	Volltext
Tags:	Tag hinzufügen Keine Tags, Fügen Sie den ersten Tag hinzu!

Beschreibung
Zusammenfassung:	The recent re-emergence of tuberculosis, especially the multidrug-resistant cases, has highlighted the importance of screening effective novel drugs against Mycobacterium tuberculosis. In this study, the in vitro activities of small peptides isolated from snake venom were investigated against multidrug-resistant M. tuberculosis. Minimum inhibitory concentrations (MICs) were determined by the Bactec TB-460 radiometric method. A small peptide with the amino acid sequence ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG (designated as vgf-1) from Naja atra (isolated from Yunnan province of China) venom had in vitro activity against clinically isolated multidrug-resistant strains of M. tuberculosis. The MIC was 8.5 mg/l. The antimycobacterial domain of this 60aa peptide is under investigation.
ISSN:	0924-8579 1872-7913
DOI:	10.1016/S0924-8579(03)00110-9