Zinc-Binding Peptides from Protein of Cicer arietinum
A zinc-binding peptide was obtained from the albumin fraction of chickpea Cicer arietinum by separating Zn 2+ using immobilizing metal-affinity chromatography followed by isolation using reversed-phase HPLC. GC-MS results showed that the molecular mass of the peptide was 3896 Da and that the peptide...
Gespeichert in:
Veröffentlicht in: | Chemistry of natural compounds 2022, Vol.58 (1), p.86-89 |
---|---|
Hauptverfasser: | , , , , , , , |
Format: | Artikel |
Sprache: | eng |
Schlagworte: | |
Online-Zugang: | Volltext |
Tags: |
Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
|
Zusammenfassung: | A zinc-binding peptide was obtained from the albumin fraction of chickpea Cicer arietinum by separating Zn
2+
using immobilizing metal-affinity chromatography followed by isolation using reversed-phase HPLC. GC-MS results showed that the molecular mass of the peptide was 3896 Da and that the peptide consisted of the 34 amino-acid residues IVQQPDGEKSERKIENENGEGEDGEQDLTVYDFE. This peptide was determined to be a fragment of a protein with a zinc finger. |
---|---|
ISSN: | 0009-3130 1573-8388 |
DOI: | 10.1007/s10600-022-03602-3 |