Zinc-Binding Peptides from Protein of Cicer arietinum

A zinc-binding peptide was obtained from the albumin fraction of chickpea Cicer arietinum by separating Zn 2+ using immobilizing metal-affinity chromatography followed by isolation using reversed-phase HPLC. GC-MS results showed that the molecular mass of the peptide was 3896 Da and that the peptide...

Ausführliche Beschreibung

Gespeichert in:
Bibliographische Detailangaben
Veröffentlicht in:Chemistry of natural compounds 2022, Vol.58 (1), p.86-89
Hauptverfasser: Mukhamedov, N., Mirzaakhmedov, Sh. Ya, Gao, Y. H., Waili, A., Ziyavitdinov, Zh. F., Bozorov, S. S., Aisa, H. A., Yili, A.
Format: Artikel
Sprache:eng
Schlagworte:
Online-Zugang:Volltext
Tags: Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
Beschreibung
Zusammenfassung:A zinc-binding peptide was obtained from the albumin fraction of chickpea Cicer arietinum by separating Zn 2+ using immobilizing metal-affinity chromatography followed by isolation using reversed-phase HPLC. GC-MS results showed that the molecular mass of the peptide was 3896 Da and that the peptide consisted of the 34 amino-acid residues IVQQPDGEKSERKIENENGEGEDGEQDLTVYDFE. This peptide was determined to be a fragment of a protein with a zinc finger.
ISSN:0009-3130
1573-8388
DOI:10.1007/s10600-022-03602-3