NANO ANTIBODY AND USE THEREOF

Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO:1), wherein X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used t...

Ausführliche Beschreibung

Gespeichert in:
Bibliographische Detailangaben
Hauptverfasser: QIN, Yaobin, YANG, Jianfeng, SONG, Zhe, ZHANG, Lei, LI, Xianggan, DONG, Qiuping, ZHU, Zhiwei, LI, Yuejin, QI, Youlin, HOU, Limin, WANG, Jinyu
Format: Patent
Sprache:chi ; eng ; fre
Schlagworte:
Online-Zugang:Volltext bestellen
Tags: Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
Beschreibung
Zusammenfassung:Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO:1), wherein X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for detecting Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein. L'invention concerne un nanoanticorps dont la séquence d'acides aminés est EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO : 1), dans laquelle X1 est choisi parmi Y ou F, et X2 est choisi parmi F ou L. L'anticorps peut être utilisé pour dissoudre des cristaux de Charcot-Leyden (CLC), ce qui permet de réduire l'inflammation pulmonaire, les