MENNISKOLEUKOCYTINTERFERON N OCH FORFARANDE FOR FRAMSTELLNING DERAV I BAKTERIECELLER
PCT No. PCT/SU84/00007 Sec. 371 Date Sep. 28, 1984 Sec. 102(e) Date Sep. 28, 1984 PCT Filed Feb. 23, 1984 PCT Pub. No. WO84/03300 PCT Pub. Date Aug. 30, 1984.The human leukocyte interferon is essentially a protein featuring the following sequence of aminoacids: CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGF...
Gespeichert in:
Hauptverfasser: | , , , , , , , , , , , , |
---|---|
Format: | Patent |
Sprache: | swe |
Schlagworte: | |
Online-Zugang: | Volltext bestellen |
Tags: |
Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
|
Zusammenfassung: | PCT No. PCT/SU84/00007 Sec. 371 Date Sep. 28, 1984 Sec. 102(e) Date Sep. 28, 1984 PCT Filed Feb. 23, 1984 PCT Pub. No. WO84/03300 PCT Pub. Date Aug. 30, 1984.The human leukocyte interferon is essentially a protein featuring the following sequence of aminoacids: CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAF HEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNE DSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD. A method for producing said interferon N is bacterial cells incorporates isolation of matrix poly (A)-mRNA from induced human leukocytes, synthesis of the gene of said interferon, insertion in the vector plasmid pBR 322 under the control of a tryptophane promotor, and transformation of the resultant recombinant DNA of the E. coli bacterial cells. According to the invention, used as the interferon gene is the gene of interferon N featuring the following primary structure of DNA: TGT GAT CTG CCT CAG ACT CAC AGC CTG GGT AAT AGG AGG GCC TTG ATA CTC CTG GCA CAA ATG GCA AGA ATC TCT CAT TTC TCC TGC CTG AAG GAC AGA TAT GAT TTC GGA TTC CCC CAG GAG CTG TTT GAT GGC AAC CAG TTC CAG AAG GCT CAA GCC ATC TCT GCC TTC CAT GAG ATG ATC CAG CAG ACC TTC AAT CTC TTC AGC ACA AAG GAT TCA TCT GCT GCT TGG GAT GAG ACC CTC CTA GAC AAA TTC TAC ATT GAA CTT TTC CAG CAA CTG AAT GAC CTA GAA GCC TGT GTG ACA CAG GAG GTT GGG GTG GAA GAG ATT GCC CTG ATG AAT GAG GAC TCC ATC CTG GCT GTG AGG AAA TAC TTT CAA AGA ATC ACT CTT TAT CTG ATG GGG AAG AAA TAC AGC CCT TGT GCC TGG GAG GTT GTC AGA GCA GAA ATC ATG AGA TCC TTC TCT TTT TCA ACA AAC TTG CAA AAA +TR GGA TTA AGA AGG AAG GAT. The human leukocyte interferon features an antiviral potency and can find application in medical practice. |
---|