ELASTASE INHIBITOR FROM KOREAN HIRUDO NIPPONIA
An elastase-inhibiting protein which has the following amino acid sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA is useful in the treatment of diseases associated with an excess level of elastase such as rheumatoid arthritis, emphysema and psoriasis. The protein may be extracted...
Gespeichert in:
Hauptverfasser: | , , , , |
---|---|
Format: | Patent |
Sprache: | eng |
Schlagworte: | |
Online-Zugang: | Volltext bestellen |
Tags: |
Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
|
Zusammenfassung: | An elastase-inhibiting protein which has the following amino acid sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA is useful in the treatment of diseases associated with an excess level of elastase such as rheumatoid arthritis, emphysema and psoriasis. The protein may be extracted from an acetone extract of the leech, Hirudo ripponia , followed by, sequentially, gel filtration chromatography, anion-exchange chromatography and HPLC. |
---|