PROCESS FOR PRODUCING TISSUE-PLASMINOGEN ACTIVATOR DERIVATIVE
PCT No. PCT/EP90/00194 Sec. 371 Date Sep. 28, 1990 Sec. 102(e) Date Sep. 28, 1990 PCT Filed Feb. 6, 1990 PCT Pub. No. WO90/09437 PCT Pub. Date Aug. 23, 1990.A new thrombolytically active protein is not glycosylated and consists of the following amino acid sequence: 1SYQGNSDCYFGNGSAYRGTHSLTESGASCL PW...
Gespeichert in:
Hauptverfasser: | , , , , |
---|---|
Format: | Patent |
Sprache: | eng |
Schlagworte: | |
Online-Zugang: | Volltext bestellen |
Tags: |
Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
|
Zusammenfassung: | PCT No. PCT/EP90/00194 Sec. 371 Date Sep. 28, 1990 Sec. 102(e) Date Sep. 28, 1990 PCT Filed Feb. 6, 1990 PCT Pub. No. WO90/09437 PCT Pub. Date Aug. 23, 1990.A new thrombolytically active protein is not glycosylated and consists of the following amino acid sequence: 1SYQGNSDCYFGNGSAYRGTHSLTESGASCL PWNSMILIGKVYTAQNPSAQ 51ALGLGKHNYCRNPDGDAKPWCHVLKNRRLT WEYCDVPSCSTCGLRQYSQP 101QFRIKGGLFADIASHPWQAAIFAKHRRSPG ERFLCGGILISSCWILSAAH 151CFQERFPPHHLTVILGRTYRVVPGEEEQKF EVEKYIVHKEFDDDTYDNDI 201ALLQLKSDSSRCAQESSVVRTVCLPPADLQ LPDWTECELSGYGKHEALSP 251FYSERLKEAHVRLYPSSRCTSQHLLNRTVT DNMLCAGDTRSGGPQANLHD 301ACQGDSGGPLVCLNDGRMTLVGIISWGLGC GQKDVPGVYTKVTNYLDWIR 351DNMRP or said amino acid sequence with an additional N-terminal methionine. DNA sequences encoding the thrombolytically active, non-glycosylated protein and pharmaceutical compositions containing said protein are also disclosed. The protein possesses particularly favorable properties when used to dissolve blood clots. |
---|