Peptido sintético policationico con propiedades ionofóricas, antimicrobianas antitumorales e insecticidas
The invention relates to a novel class of synthetic peptides having the amino acid sequence IAPALIAVAPIAKYLATALAKWALKQGFAKLKS (SEQ ID Nº 1) that is at least 90% homologous with SEQ ID Nº 1. The peptides of the invention have ionophoric, antimicrobial, anti-tumour and insecticidal activity. The inven...
Gespeichert in:
Hauptverfasser: | , |
---|---|
Format: | Patent |
Sprache: | spa |
Schlagworte: | |
Online-Zugang: | Volltext bestellen |
Tags: |
Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
|
Zusammenfassung: | The invention relates to a novel class of synthetic peptides having the amino acid sequence IAPALIAVAPIAKYLATALAKWALKQGFAKLKS (SEQ ID Nº 1) that is at least 90% homologous with SEQ ID Nº 1. The peptides of the invention have ionophoric, antimicrobial, anti-tumour and insecticidal activity. The invention also relates to agricultural and pharmaceutical compositions containing same, which can be used in the inhibition of tumoral and microbial growth.. |
---|