The structural homology of amicyanin from Thiobacillus versutus to plant plastocyanins
The complete amino acid sequence of the blue copper protein amicyanin of Thiobacillus versutus, induced when the bacterium is grown on methylamine, has been determined as follows: QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGEVMPHNVA FKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMRGKVIVE. The four co...
Gespeichert in:
Veröffentlicht in: | The Journal of biological chemistry 1991-03, Vol.266 (8), p.4869-4877 |
---|---|
Hauptverfasser: | , , , , |
Format: | Artikel |
Sprache: | eng |
Schlagworte: | |
Online-Zugang: | Volltext |
Tags: |
Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
|
container_end_page | 4877 |
---|---|
container_issue | 8 |
container_start_page | 4869 |
container_title | The Journal of biological chemistry |
container_volume | 266 |
creator | Van Beeumen, J Van Bun, S Canters, G W Lommen, A Chothia, C |
description | The complete amino acid sequence of the blue copper protein amicyanin of Thiobacillus versutus, induced when the bacterium is grown on methylamine, has been determined as follows: QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGEVMPHNVA FKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMRGKVIVE. The four copper ligand residues in this 106-residue-containing polypeptide chain are His54, Cys93, His96, and Met99. The Thiobacillus amicyanin is 52% similar to the amicyanin of Pseudomonas AM1, the only other copper protein known with the same spacing between the second histidine ligand and the methionine ligand. T. versutus amicyanin contains no cysteine bridge and is more closely related to the plant copper protein plastocyanin than to the bacterial copper protein azurin. Alignment of the two known amicyanin sequences with the consensus sequence of the plastocyanins and comparison with the known three-dimensional structure of poplar leaves plastocyanin reveals that the bacterial proteins have the same overall structure with two beta-sheets packed face to face. The major structural differences between the amicyanins and the plastocyanins appear to be located in two of the five loops that connect the six identified beta-strands of the amicyanins. The first of these two loops, connecting strands F and G, contains a ligand histidine and must have a different conformation from the same loop in the plastocyanins because it is shorter by two amino acids. Further differences occur in the loop connecting the strands D and E. This loop contains only 17 residues in amicyanin whereas the corresponding loop of plastocyanin contains 25 residues. Despite these differences the amicyanins appear much closer related to the plastocyanins than to the azurins. The present findings demonstrate that the occurrence of blue copper proteins with clearly plastocyanin-like features is not restricted to photosynthetic redox chains. |
doi_str_mv | 10.1016/S0021-9258(19)67729-X |
format | Article |
fullrecord | <record><control><sourceid>proquest_cross</sourceid><recordid>TN_cdi_proquest_miscellaneous_80471983</recordid><sourceformat>XML</sourceformat><sourcesystem>PC</sourcesystem><els_id>S002192581967729X</els_id><sourcerecordid>80471983</sourcerecordid><originalsourceid>FETCH-LOGICAL-c495t-1e598d8ba30d6b1a1773f388306a20f402119e088eb58ae6e41e4e869f433be83</originalsourceid><addsrcrecordid>eNqFkEFr3DAQhUVpSTZpf0LABFqSg1uNZcvSqZSQpIVAD92WvQlZHscKtrWR5JT999XGS3qMDpJgvvfm8Qg5A_oZKPAvvygtIJdFJS5AXvK6LmS-eUNWQAXLWQWbt2T1ghyTkxAeaDqlhCNyVKQJZWxF_qx7zEL0s4mz10PWu9EN7n6XuS7TozU7Pdkp67wbs3VvXaONHYY5ZE_owxzTJ7psO-gp7u8Q3SII78m7Tg8BPxzeU_L75np99T2_-3n74-rbXW5KWcUcsJKiFY1mtOUNaKhr1jEhGOW6oF2Z4oNEKgQ2ldDIsQQsUXDZlYw1KNgp-bT4br17nDFENdpgcEiJ0M1BCVrWIAV7FYQquVJWJLBaQONdCB47tfV21H6ngKp98eq5eLVvVYFUz8WrTdKdHRbMzYjti-rQdJp_PMx1MHrovJ6MDf_NJZeionXizheut_f9X-tRNdaZHkdVcK6EKlPOBH1dIEzdPln0KhiLk8E2CUxUrbOvxP0HaOmr1w</addsrcrecordid><sourcetype>Aggregation Database</sourcetype><iscdi>true</iscdi><recordtype>article</recordtype><pqid>15869032</pqid></control><display><type>article</type><title>The structural homology of amicyanin from Thiobacillus versutus to plant plastocyanins</title><source>MEDLINE</source><source>EZB-FREE-00999 freely available EZB journals</source><source>Alma/SFX Local Collection</source><creator>Van Beeumen, J ; Van Bun, S ; Canters, G W ; Lommen, A ; Chothia, C</creator><creatorcontrib>Van Beeumen, J ; Van Bun, S ; Canters, G W ; Lommen, A ; Chothia, C</creatorcontrib><description>The complete amino acid sequence of the blue copper protein amicyanin of Thiobacillus versutus, induced when the bacterium is grown on methylamine, has been determined as follows: QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGEVMPHNVA FKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMRGKVIVE. The four copper ligand residues in this 106-residue-containing polypeptide chain are His54, Cys93, His96, and Met99. The Thiobacillus amicyanin is 52% similar to the amicyanin of Pseudomonas AM1, the only other copper protein known with the same spacing between the second histidine ligand and the methionine ligand. T. versutus amicyanin contains no cysteine bridge and is more closely related to the plant copper protein plastocyanin than to the bacterial copper protein azurin. Alignment of the two known amicyanin sequences with the consensus sequence of the plastocyanins and comparison with the known three-dimensional structure of poplar leaves plastocyanin reveals that the bacterial proteins have the same overall structure with two beta-sheets packed face to face. The major structural differences between the amicyanins and the plastocyanins appear to be located in two of the five loops that connect the six identified beta-strands of the amicyanins. The first of these two loops, connecting strands F and G, contains a ligand histidine and must have a different conformation from the same loop in the plastocyanins because it is shorter by two amino acids. Further differences occur in the loop connecting the strands D and E. This loop contains only 17 residues in amicyanin whereas the corresponding loop of plastocyanin contains 25 residues. Despite these differences the amicyanins appear much closer related to the plastocyanins than to the azurins. The present findings demonstrate that the occurrence of blue copper proteins with clearly plastocyanin-like features is not restricted to photosynthetic redox chains.</description><identifier>ISSN: 0021-9258</identifier><identifier>EISSN: 1083-351X</identifier><identifier>DOI: 10.1016/S0021-9258(19)67729-X</identifier><identifier>PMID: 2002033</identifier><identifier>CODEN: JBCHA3</identifier><language>eng</language><publisher>Bethesda, MD: Elsevier Inc</publisher><subject>amicyanin ; Amino Acid Sequence ; Amino Acids - analysis ; Analytical, structural and metabolic biochemistry ; Bacterial Proteins - genetics ; Biological and medical sciences ; Chromatography, High Pressure Liquid ; copper ; Fundamental and applied biological sciences. Psychology ; Hydrolysis ; Metalloproteins ; Molecular Sequence Data ; Other metalloproteins ; plants ; Plants - metabolism ; Plastocyanin - genetics ; Proteins ; Pseudomonas - metabolism ; respiratory pigments ; Sequence Alignment ; Sequence Homology, Nucleic Acid ; Thiobacillus - metabolism</subject><ispartof>The Journal of biological chemistry, 1991-03, Vol.266 (8), p.4869-4877</ispartof><rights>1991 © 1991 ASBMB. Currently published by Elsevier Inc; originally published by American Society for Biochemistry and Molecular Biology.</rights><rights>1991 INIST-CNRS</rights><lds50>peer_reviewed</lds50><oa>free_for_read</oa><woscitedreferencessubscribed>false</woscitedreferencessubscribed><citedby>FETCH-LOGICAL-c495t-1e598d8ba30d6b1a1773f388306a20f402119e088eb58ae6e41e4e869f433be83</citedby><cites>FETCH-LOGICAL-c495t-1e598d8ba30d6b1a1773f388306a20f402119e088eb58ae6e41e4e869f433be83</cites></display><links><openurl>$$Topenurl_article</openurl><openurlfulltext>$$Topenurlfull_article</openurlfulltext><thumbnail>$$Tsyndetics_thumb_exl</thumbnail><link.rule.ids>314,780,784,27922,27923</link.rule.ids><backlink>$$Uhttp://pascal-francis.inist.fr/vibad/index.php?action=getRecordDetail&idt=19698507$$DView record in Pascal Francis$$Hfree_for_read</backlink><backlink>$$Uhttps://www.ncbi.nlm.nih.gov/pubmed/2002033$$D View this record in MEDLINE/PubMed$$Hfree_for_read</backlink></links><search><creatorcontrib>Van Beeumen, J</creatorcontrib><creatorcontrib>Van Bun, S</creatorcontrib><creatorcontrib>Canters, G W</creatorcontrib><creatorcontrib>Lommen, A</creatorcontrib><creatorcontrib>Chothia, C</creatorcontrib><title>The structural homology of amicyanin from Thiobacillus versutus to plant plastocyanins</title><title>The Journal of biological chemistry</title><addtitle>J Biol Chem</addtitle><description>The complete amino acid sequence of the blue copper protein amicyanin of Thiobacillus versutus, induced when the bacterium is grown on methylamine, has been determined as follows: QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGEVMPHNVA FKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMRGKVIVE. The four copper ligand residues in this 106-residue-containing polypeptide chain are His54, Cys93, His96, and Met99. The Thiobacillus amicyanin is 52% similar to the amicyanin of Pseudomonas AM1, the only other copper protein known with the same spacing between the second histidine ligand and the methionine ligand. T. versutus amicyanin contains no cysteine bridge and is more closely related to the plant copper protein plastocyanin than to the bacterial copper protein azurin. Alignment of the two known amicyanin sequences with the consensus sequence of the plastocyanins and comparison with the known three-dimensional structure of poplar leaves plastocyanin reveals that the bacterial proteins have the same overall structure with two beta-sheets packed face to face. The major structural differences between the amicyanins and the plastocyanins appear to be located in two of the five loops that connect the six identified beta-strands of the amicyanins. The first of these two loops, connecting strands F and G, contains a ligand histidine and must have a different conformation from the same loop in the plastocyanins because it is shorter by two amino acids. Further differences occur in the loop connecting the strands D and E. This loop contains only 17 residues in amicyanin whereas the corresponding loop of plastocyanin contains 25 residues. Despite these differences the amicyanins appear much closer related to the plastocyanins than to the azurins. The present findings demonstrate that the occurrence of blue copper proteins with clearly plastocyanin-like features is not restricted to photosynthetic redox chains.</description><subject>amicyanin</subject><subject>Amino Acid Sequence</subject><subject>Amino Acids - analysis</subject><subject>Analytical, structural and metabolic biochemistry</subject><subject>Bacterial Proteins - genetics</subject><subject>Biological and medical sciences</subject><subject>Chromatography, High Pressure Liquid</subject><subject>copper</subject><subject>Fundamental and applied biological sciences. Psychology</subject><subject>Hydrolysis</subject><subject>Metalloproteins</subject><subject>Molecular Sequence Data</subject><subject>Other metalloproteins</subject><subject>plants</subject><subject>Plants - metabolism</subject><subject>Plastocyanin - genetics</subject><subject>Proteins</subject><subject>Pseudomonas - metabolism</subject><subject>respiratory pigments</subject><subject>Sequence Alignment</subject><subject>Sequence Homology, Nucleic Acid</subject><subject>Thiobacillus - metabolism</subject><issn>0021-9258</issn><issn>1083-351X</issn><fulltext>true</fulltext><rsrctype>article</rsrctype><creationdate>1991</creationdate><recordtype>article</recordtype><sourceid>EIF</sourceid><recordid>eNqFkEFr3DAQhUVpSTZpf0LABFqSg1uNZcvSqZSQpIVAD92WvQlZHscKtrWR5JT999XGS3qMDpJgvvfm8Qg5A_oZKPAvvygtIJdFJS5AXvK6LmS-eUNWQAXLWQWbt2T1ghyTkxAeaDqlhCNyVKQJZWxF_qx7zEL0s4mz10PWu9EN7n6XuS7TozU7Pdkp67wbs3VvXaONHYY5ZE_owxzTJ7psO-gp7u8Q3SII78m7Tg8BPxzeU_L75np99T2_-3n74-rbXW5KWcUcsJKiFY1mtOUNaKhr1jEhGOW6oF2Z4oNEKgQ2ldDIsQQsUXDZlYw1KNgp-bT4br17nDFENdpgcEiJ0M1BCVrWIAV7FYQquVJWJLBaQONdCB47tfV21H6ngKp98eq5eLVvVYFUz8WrTdKdHRbMzYjti-rQdJp_PMx1MHrovJ6MDf_NJZeionXizheut_f9X-tRNdaZHkdVcK6EKlPOBH1dIEzdPln0KhiLk8E2CUxUrbOvxP0HaOmr1w</recordid><startdate>19910315</startdate><enddate>19910315</enddate><creator>Van Beeumen, J</creator><creator>Van Bun, S</creator><creator>Canters, G W</creator><creator>Lommen, A</creator><creator>Chothia, C</creator><general>Elsevier Inc</general><general>American Society for Biochemistry and Molecular Biology</general><scope>6I.</scope><scope>AAFTH</scope><scope>IQODW</scope><scope>CGR</scope><scope>CUY</scope><scope>CVF</scope><scope>ECM</scope><scope>EIF</scope><scope>NPM</scope><scope>AAYXX</scope><scope>CITATION</scope><scope>7QL</scope><scope>8FD</scope><scope>C1K</scope><scope>FR3</scope><scope>M81</scope><scope>P64</scope><scope>7X8</scope></search><sort><creationdate>19910315</creationdate><title>The structural homology of amicyanin from Thiobacillus versutus to plant plastocyanins</title><author>Van Beeumen, J ; Van Bun, S ; Canters, G W ; Lommen, A ; Chothia, C</author></sort><facets><frbrtype>5</frbrtype><frbrgroupid>cdi_FETCH-LOGICAL-c495t-1e598d8ba30d6b1a1773f388306a20f402119e088eb58ae6e41e4e869f433be83</frbrgroupid><rsrctype>articles</rsrctype><prefilter>articles</prefilter><language>eng</language><creationdate>1991</creationdate><topic>amicyanin</topic><topic>Amino Acid Sequence</topic><topic>Amino Acids - analysis</topic><topic>Analytical, structural and metabolic biochemistry</topic><topic>Bacterial Proteins - genetics</topic><topic>Biological and medical sciences</topic><topic>Chromatography, High Pressure Liquid</topic><topic>copper</topic><topic>Fundamental and applied biological sciences. Psychology</topic><topic>Hydrolysis</topic><topic>Metalloproteins</topic><topic>Molecular Sequence Data</topic><topic>Other metalloproteins</topic><topic>plants</topic><topic>Plants - metabolism</topic><topic>Plastocyanin - genetics</topic><topic>Proteins</topic><topic>Pseudomonas - metabolism</topic><topic>respiratory pigments</topic><topic>Sequence Alignment</topic><topic>Sequence Homology, Nucleic Acid</topic><topic>Thiobacillus - metabolism</topic><toplevel>peer_reviewed</toplevel><toplevel>online_resources</toplevel><creatorcontrib>Van Beeumen, J</creatorcontrib><creatorcontrib>Van Bun, S</creatorcontrib><creatorcontrib>Canters, G W</creatorcontrib><creatorcontrib>Lommen, A</creatorcontrib><creatorcontrib>Chothia, C</creatorcontrib><collection>ScienceDirect Open Access Titles</collection><collection>Elsevier:ScienceDirect:Open Access</collection><collection>Pascal-Francis</collection><collection>Medline</collection><collection>MEDLINE</collection><collection>MEDLINE (Ovid)</collection><collection>MEDLINE</collection><collection>MEDLINE</collection><collection>PubMed</collection><collection>CrossRef</collection><collection>Bacteriology Abstracts (Microbiology B)</collection><collection>Technology Research Database</collection><collection>Environmental Sciences and Pollution Management</collection><collection>Engineering Research Database</collection><collection>Biochemistry Abstracts 3</collection><collection>Biotechnology and BioEngineering Abstracts</collection><collection>MEDLINE - Academic</collection><jtitle>The Journal of biological chemistry</jtitle></facets><delivery><delcategory>Remote Search Resource</delcategory><fulltext>fulltext</fulltext></delivery><addata><au>Van Beeumen, J</au><au>Van Bun, S</au><au>Canters, G W</au><au>Lommen, A</au><au>Chothia, C</au><format>journal</format><genre>article</genre><ristype>JOUR</ristype><atitle>The structural homology of amicyanin from Thiobacillus versutus to plant plastocyanins</atitle><jtitle>The Journal of biological chemistry</jtitle><addtitle>J Biol Chem</addtitle><date>1991-03-15</date><risdate>1991</risdate><volume>266</volume><issue>8</issue><spage>4869</spage><epage>4877</epage><pages>4869-4877</pages><issn>0021-9258</issn><eissn>1083-351X</eissn><coden>JBCHA3</coden><abstract>The complete amino acid sequence of the blue copper protein amicyanin of Thiobacillus versutus, induced when the bacterium is grown on methylamine, has been determined as follows: QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGEVMPHNVA FKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMRGKVIVE. The four copper ligand residues in this 106-residue-containing polypeptide chain are His54, Cys93, His96, and Met99. The Thiobacillus amicyanin is 52% similar to the amicyanin of Pseudomonas AM1, the only other copper protein known with the same spacing between the second histidine ligand and the methionine ligand. T. versutus amicyanin contains no cysteine bridge and is more closely related to the plant copper protein plastocyanin than to the bacterial copper protein azurin. Alignment of the two known amicyanin sequences with the consensus sequence of the plastocyanins and comparison with the known three-dimensional structure of poplar leaves plastocyanin reveals that the bacterial proteins have the same overall structure with two beta-sheets packed face to face. The major structural differences between the amicyanins and the plastocyanins appear to be located in two of the five loops that connect the six identified beta-strands of the amicyanins. The first of these two loops, connecting strands F and G, contains a ligand histidine and must have a different conformation from the same loop in the plastocyanins because it is shorter by two amino acids. Further differences occur in the loop connecting the strands D and E. This loop contains only 17 residues in amicyanin whereas the corresponding loop of plastocyanin contains 25 residues. Despite these differences the amicyanins appear much closer related to the plastocyanins than to the azurins. The present findings demonstrate that the occurrence of blue copper proteins with clearly plastocyanin-like features is not restricted to photosynthetic redox chains.</abstract><cop>Bethesda, MD</cop><pub>Elsevier Inc</pub><pmid>2002033</pmid><doi>10.1016/S0021-9258(19)67729-X</doi><tpages>9</tpages><oa>free_for_read</oa></addata></record> |
fulltext | fulltext |
identifier | ISSN: 0021-9258 |
ispartof | The Journal of biological chemistry, 1991-03, Vol.266 (8), p.4869-4877 |
issn | 0021-9258 1083-351X |
language | eng |
recordid | cdi_proquest_miscellaneous_80471983 |
source | MEDLINE; EZB-FREE-00999 freely available EZB journals; Alma/SFX Local Collection |
subjects | amicyanin Amino Acid Sequence Amino Acids - analysis Analytical, structural and metabolic biochemistry Bacterial Proteins - genetics Biological and medical sciences Chromatography, High Pressure Liquid copper Fundamental and applied biological sciences. Psychology Hydrolysis Metalloproteins Molecular Sequence Data Other metalloproteins plants Plants - metabolism Plastocyanin - genetics Proteins Pseudomonas - metabolism respiratory pigments Sequence Alignment Sequence Homology, Nucleic Acid Thiobacillus - metabolism |
title | The structural homology of amicyanin from Thiobacillus versutus to plant plastocyanins |
url | https://sfx.bib-bvb.de/sfx_tum?ctx_ver=Z39.88-2004&ctx_enc=info:ofi/enc:UTF-8&ctx_tim=2025-01-14T00%3A11%3A11IST&url_ver=Z39.88-2004&url_ctx_fmt=infofi/fmt:kev:mtx:ctx&rfr_id=info:sid/primo.exlibrisgroup.com:primo3-Article-proquest_cross&rft_val_fmt=info:ofi/fmt:kev:mtx:journal&rft.genre=article&rft.atitle=The%20structural%20homology%20of%20amicyanin%20from%20Thiobacillus%20versutus%20to%20plant%20plastocyanins&rft.jtitle=The%20Journal%20of%20biological%20chemistry&rft.au=Van%20Beeumen,%20J&rft.date=1991-03-15&rft.volume=266&rft.issue=8&rft.spage=4869&rft.epage=4877&rft.pages=4869-4877&rft.issn=0021-9258&rft.eissn=1083-351X&rft.coden=JBCHA3&rft_id=info:doi/10.1016/S0021-9258(19)67729-X&rft_dat=%3Cproquest_cross%3E80471983%3C/proquest_cross%3E%3Curl%3E%3C/url%3E&disable_directlink=true&sfx.directlink=off&sfx.report_link=0&rft_id=info:oai/&rft_pqid=15869032&rft_id=info:pmid/2002033&rft_els_id=S002192581967729X&rfr_iscdi=true |